- CHMP2A Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-91780
- Human
- BC-2, BC2, CHMP2, VPS2, VPS2A
- Unconjugated
- PBS (pH 7.2) and 40% Glycerol
- Immunohistochemistry, Immunohistochemistry-Paraffin
- CHMP2A
- 0.1 ml (also 25ul)
- Rabbit
- This antibody was developed against Recombinant Protein corresponding to amino acids: NIQAVSLKIQ TLKSNNSMAQ AMKGVTKAMG TMNRQLKLPQ IQKIMMEFER QAEIMDMKEE MMNDAIDDAM
- charged multivesicular body protein 2A
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Autophagy, Cell Biology, Signal Transduction
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
NIQAVSLKIQTLKSNNSMAQAMKGVTKAMGTMNRQLKLPQIQKIMMEFERQAEIMDMKEEMMNDAIDDAM
Specifications/Features
Available conjugates: Unconjugated